PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00142.28
Common NameAMTR_s00142p00049490
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family G2-like
Protein Properties Length: 482aa    MW: 52283.8 Da    PI: 5.2073
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00142.28genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like109.12.3e-34272326155
                                  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                              k+r+rWtpeLHe+Fveav+qLGGse+AtPk +l+lmkv+gLt++hvkSHLQkYR+
  evm_27.model.AmTr_v1.0_scaffold00142.28 272 KARMRWTPELHECFVEAVNQLGGSERATPKGVLKLMKVEGLTIYHVKSHLQKYRT 326
                                              68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.256269329IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.4E-32271328IPR009057Homeodomain-like
SuperFamilySSF466898.42E-18271326IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-25272326IPR006447Myb domain, plants
PfamPF002493.3E-10274325IPR001005SANT/Myb domain
PfamPF143794.0E-25357403IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0016036Biological Processcellular response to phosphate starvation
GO:0055063Biological Processsulfate ion homeostasis
GO:0071486Biological Processcellular response to high light intensity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 482 aa     Download sequence    Send to blast
MEVRPAFSIR SSNTMQHNSS LGMPQGPSSS LPCLSAPLED RQPKFPSTQQ AGMGKELRPS  60
TVGPLTGPVA SNNGVVGPIF STGSAFSNDL HFSSSISQRQ GHSSSSPFIS QASSNFISQE  120
SSNFISQASS NSTSLSLLHS SQSGDIFQPV ASDFTKESND VSWSSDPLQG FLDFPDNVGE  180
SSQHNGMDGD DQTRRTDWGA WTDQLIGDDE TLPAGWSDLL LDTNAADPQP KTPKLSSDFK  240
VQQGPLPQLA PALSGEFCSV SSPSSGNGGT NKARMRWTPE LHECFVEAVN QLGGSERATP  300
KGVLKLMKVE GLTIYHVKSH LQKYRTARYR PDISEGNAEK KMTRLDDIST LDLKTGIEIT  360
EALRLQMEVQ KRLHEQLEIQ RNLQLRIEEQ GRYLQMMFEK QSKGGVDKLK AQIASESDPS  420
VPSDSTLSLS KTDFSAKESV ERNNATITLE EPHVNTQSDS GSQYPPAKRL KSGDPSSSIS  480
E*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011623361.10.0PREDICTED: protein PHR1-LIKE 1
TrEMBLW1P8260.0W1P826_AMBTC; Uncharacterized protein
STRINGVIT_07s0005g04120.t011e-143(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP7817262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.16e-91phosphate starvation response 1
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]